PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G017800.2.p
Common NameGLYMA_06G017800, LOC100785135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 910aa    MW: 101276 Da    PI: 5.7251
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G017800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29593644152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Glyma.06G017800.2.p 593 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 644
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.406.7E-4205298IPR029016GAF domain-like
PROSITE profilePS5151917.837581664IPR003035RWP-RK domain
PfamPF020426.4E-25596644IPR003035RWP-RK domain
SuperFamilySSF542777.36E-22815900No hitNo description
PROSITE profilePS5174525.565815898IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.0E-21815895No hitNo description
SMARTSM006662.9E-22815898IPR000270PB1 domain
CDDcd064078.46E-40816897No hitNo description
PfamPF005641.0E-17816897IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 910 aa     Download sequence    Send to blast
MMGDGGVISS AATMMEAPPP DGTTTTSMDF DYMGELFLDG CWMEASADGS DFLLQSPSFS  60
NTLFDPSFSW PALETNHNES QVAAFGSQQE SHNNNMVSVV AGGDYSQQFQ SETHSVEGAS  120
EGIRRWWFAP THTPTPSPGP GPSIMEKLIR ALMWIKDYNR NKDMLIQIWV PVHKEGRPIL  180
AADDLLFSLE SKSLNLAKYR EISVTYKFSA EESDSKELAW GLPGRVFRDK VPEWTPDVRF  240
FKIDEYPRVD HAQEYDVRGT LAVPIFEQGS KTCLGVIEVV MTTQQINYGP ELESVCKALE  300
AVDLRSSKQL SIQNVKACNR SYEAALPEIH EVLRSACEMH KLPLAQTWVP CVQQGKEGCR  360
HSEDNYLLCI SPVEHACYVG DPSIRSFHEA CTEHHLLKGE GVAGGAFMTN QPCFSDDITS  420
LSKKDYPMSH HARLFGLRAA VAIRLRSIYN STDDFVLEFF LPVDCNDIEE QRKMLTSLSN  480
IIQRVCRSLR VIREKELEEA NLSVNEVIAL ADSGFTRDEI CSEPQQKGMV ASLDTEEKSS  540
ETMGRKFSEP RQQQESPILK GNLDCVRECS TSVEGNLSSP GTSKTGERRR VKAEKTITLQ  600
VLRQYFAGSL KDAAKNIGVC TTTLKRICRQ HGIKRWPSRK IKKVGHSLQK LQLVIDSVQG  660
ASGAFQINSF YSNFPDLASP NLSGTGFFST LNQSDNPNST STQPEHGSLS PEGASKSPSS  720
SSSQSSISSH SCSSMSELQQ QHTTNIASDK DPATVGEYSA DVVLKLIRNE AKLKSLSQDR  780
AKLLPRSLSQ ETLGEHPKTQ YQLPLLKTSS SKVDSHRVKV TYGDEKTRFR MLKNWVYEDL  840
LQEIGRKFNV SDMSKFDVKY LDDDCEWILL TCDADLEECI DVCQSSESGT IKLSLQPSSH  900
SVRSSLEFR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.621420.0cotyledon| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581139.10.0PREDICTED: protein NLP4-like isoform X2
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLK7KSJ10.0K7KSJ1_SOYBN; Uncharacterized protein
STRINGGLYMA06G02030.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein